Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial, Biotinylated

This Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial, Biotinylated spans the amino acid sequence from region 1-39. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4-2 NPY4R2

UniProt

P0DQD5

Expression Region

1-39

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inpp4a (NM_031002) Rat Tagged ORF Clone
RR207509 10 µg

Inpp4a (NM_031002) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Prdh-1 Antibody
orb801574 2 mg

Prdh-1 Antibody

Sign In for Pricing
View Details
Recombinant Erwinia amylovora Harpin secretion protein hrcR (hrcR), partial
MBS7080131 Inquire

Recombinant Erwinia amylovora Harpin secretion protein hrcR (hrcR), partial

Sign In for Pricing
View Details
Profilin 1 (PFN1) Recombinant, Human
156451-01 10 µg

Profilin 1 (PFN1) Recombinant, Human

Sign In for Pricing
View Details
Profilin 1 (PFN1) Recombinant, Human
156451-02 50 µg

Profilin 1 (PFN1) Recombinant, Human

Sign In for Pricing
View Details
Profilin 1 (PFN1) Recombinant, Human
156451-03 200 µg

Profilin 1 (PFN1) Recombinant, Human

Sign In for Pricing
View Details