Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated

This Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytokeratin 17 Antibody Clone E3; same as Ks17.E3, Unconjugated-100ug
3872-MSM1-P1 100ug

Anti-Cytokeratin 17 Antibody Clone E3; same as Ks17.E3, Unconjugated-100ug

Sign In for Pricing
View Details
JNK2/MAPK9 Rabbit Polyclonal Antibody
orb308757 100 µg

JNK2/MAPK9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKAP7 (NM_016377) Human Over-expression Lysate
LC429496 20 µg

AKAP7 (NM_016377) Human Over-expression Lysate

Sign In for Pricing
View Details
Neo-resistant MEF Cells, P2, untreated
ILF-3005 1 Vial - 1x 10^6 Cells

Neo-resistant MEF Cells, P2, untreated

Sign In for Pricing
View Details
GSPT2 siRNA (Human)
orb1859819-01 15 nmol

GSPT2 siRNA (Human)

Sign In for Pricing
View Details
GSPT2 siRNA (Human)
orb1859819-02 30 nmol

GSPT2 siRNA (Human)

Sign In for Pricing
View Details