Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated

This Recombinant Human Splicing regulatory small protein (SRSP), Biotinylated spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-12 R beta 2 Protein (Lys 24-Asn 622) [Fc]
VAng-1762Lsx-100g 100 µg

Human IL-12 R beta 2 Protein (Lys 24-Asn 622) [Fc]

Sign In for Pricing
View Details
SERPINB12 Antibody
E93535 100 µg

SERPINB12 Antibody

Sign In for Pricing
View Details
OR2T3 Protein Vector (Human) (pPM-C-His)
PV106701 500 ng

OR2T3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ENAM Antibody (C-term)
E45R32208G-1 100 µL

ENAM Antibody (C-term)

Sign In for Pricing
View Details
Recombinant Hemagglutinin Influenza B Virus Ohio 01/05 (HA full length, insect cells)
RP-646 2 µg

Recombinant Hemagglutinin Influenza B Virus Ohio 01/05 (HA full length, insect cells)

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus Envelope Antibody [Alexa Fluor 405]
NBP2-41056AF405 0.1 mL

Rabbit Polyclonal West Nile Virus Envelope Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details