Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ribosomal subunit protein mS33 (RT33), Biotinylated

This Recombinant Human Small ribosomal subunit protein mS33 (RT33), Biotinylated spans the amino acid sequence from region 2-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ribosomal subunit protein mS33; 28S ribosomal protein S33, mitochondrial; MRP-S33; S33mt; MRPS33 CGI-139 PTD003

UniProt

Q9Y291

Expression Region

2-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OVCA1 Rabbit pAb
GB114439-50 50 μL

Anti-OVCA1 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC4F10.05c Polyclonal Antibody
MBS7179910 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC4F10.05c Polyclonal Antibody

Sign In for Pricing
View Details
Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin
MBS406620-01 1 g

Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin

Sign In for Pricing
View Details
Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin
MBS406620-02 5 g

Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin

Sign In for Pricing
View Details
Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin
MBS406620-03 5x 5 g

Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin

Sign In for Pricing
View Details
UVRAG Antibody
orb2672835-01 50 µL

UVRAG Antibody

Sign In for Pricing
View Details