Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial, Biotinylated

This Recombinant Human Transmembrane protein 272 (TM272), partial, Biotinylated spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK3 CRISPR Knock Out 293T Cell Line (Human)
25228141 1x 10^6 Cells / 1.0 mL

JAK3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CTTNBP2NL (NM_018704) Human Recombinant Protein
PROTQ9P2B4 20 µg

CTTNBP2NL (NM_018704) Human Recombinant Protein

Sign In for Pricing
View Details
RNF170 Rabbit Polyclonal Antibody (Cy5.5)
orb1035226 100 µL

RNF170 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS707612 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Ipo9 Mouse shRNA Lentiviral Particle (Locus ID 226432)
TL519700V 500 µL Each

Ipo9 Mouse shRNA Lentiviral Particle (Locus ID 226432)

Sign In for Pricing
View Details
HPV16 E7 Rabbit Polyclonal Antibody (Biotin)
orb447865 100 µL

HPV16 E7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details