Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja atra Cobrotoxin

Product Specifications

Product Name Alternative

(CBT) (CBTX) (CTX) (Atratoxin) (Cobratide) (Short neurotoxin 1)

Abbreviation

Recombinant Naja atra Cobrotoxin protein

UniProt

P60770

Expression Region

22-83aa

Organism

Naja atra (Chinese cobra)

Target Sequence

LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to muscle nicotinic acetylcholine receptor (nAChR) and inhibit acetylcholine from binding to the receptor, thereby impairing neuromuscular transmission. Has a higher toxicity than cobrotoxin-b. In vivo, when tested on rat arthritis models, shows anti-inflammation and immunosuppression effects.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.3 kDa

References & Citations

"Cobrotoxin extracted from Naja atra venom relieves arthritis symptoms through anti-inflammation and immunosuppression effects in rat arthritis model." Zhu Q., Huang J., Wang S.Z., Qin Z.H., Lin F. J. Ethnopharmacol. 194:1087-1095 (2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Taf7 shRNA (UAS) - Lentiviral mouse Taf7 shRNA (UAS) (25)
GTR15200057 1 Vial

Lentiviral mouse Taf7 shRNA (UAS) - Lentiviral mouse Taf7 shRNA (UAS) (25)

Sign In for Pricing
View Details
Anti-Gangliosides GQ1b Recombinant Antibody (SAA2718)
YP115113-01 50 µg

Anti-Gangliosides GQ1b Recombinant Antibody (SAA2718)

Sign In for Pricing
View Details
Anti-Gangliosides GQ1b Recombinant Antibody (SAA2718)
YP115113-02 100 µg

Anti-Gangliosides GQ1b Recombinant Antibody (SAA2718)

Sign In for Pricing
View Details
Anti-Gangliosides GQ1b Recombinant Antibody (SAA2718)
YP115113-03 1 mg

Anti-Gangliosides GQ1b Recombinant Antibody (SAA2718)

Sign In for Pricing
View Details
IQGAP2 Antibody (FITC)
orb516634-01 50 µg

IQGAP2 Antibody (FITC)

Sign In for Pricing
View Details
IQGAP2 Antibody (FITC)
orb516634-02 100 µg

IQGAP2 Antibody (FITC)

Sign In for Pricing
View Details