Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD), Biotinylated

This Recombinant Human LITAF domain-containing protein (LITAD), Biotinylated spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Argonaute 2 (AGO2) (NM_001164623) Human Recombinant Protein
TP328592L 1 mg

Argonaute 2 (AGO2) (NM_001164623) Human Recombinant Protein

Sign In for Pricing
View Details
VSIG10L Antibody
KC-3154-01 50 μL

VSIG10L Antibody

Sign In for Pricing
View Details
VSIG10L Antibody
KC-3154-02 100 µL

VSIG10L Antibody

Sign In for Pricing
View Details
VSIG10L Antibody
KC-3154-03 1 mL

VSIG10L Antibody

Sign In for Pricing
View Details
Tas2r139 Mouse Gene Knockout Kit (CRISPR)
KN517220 1 Kit

Tas2r139 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DHH Polyclonal Antibody
E-AB-66021-01 60 µL

DHH Polyclonal Antibody

Sign In for Pricing
View Details