Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD), Biotinylated

This Recombinant Human LITAF domain-containing protein (LITAD), Biotinylated spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclohexane 99% Extrapure
00907 00500 500 mL

Cyclohexane 99% Extrapure

Sign In for Pricing
View Details
Mouse Monoclonal 14-3-3 gamma Antibody (AT4B9) [DyLight 755]
NBP2-50579IR 100 µL

Mouse Monoclonal 14-3-3 gamma Antibody (AT4B9) [DyLight 755]

Sign In for Pricing
View Details
[IHC]FCGR1A Mouse Monoclonal Antibody, 1 pack = 100 µL
BAL3898 1 Each

[IHC]FCGR1A Mouse Monoclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details
Sheep Coagulation factor X III ELISA Kit
MBS736254-01 48 Well

Sheep Coagulation factor X III ELISA Kit

Sign In for Pricing
View Details
Sheep Coagulation factor X III ELISA Kit
MBS736254-02 96 Well

Sheep Coagulation factor X III ELISA Kit

Sign In for Pricing
View Details
Sheep Coagulation factor X III ELISA Kit
MBS736254-03 5x 96 Well

Sheep Coagulation factor X III ELISA Kit

Sign In for Pricing
View Details