Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 10 (SCGRX), Biotinylated

This Recombinant Human Small cysteine and glycine repeat-containing protein 10 (SCGRX), Biotinylated spans the amino acid sequence from region 1-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 10; Keratin-associated protein 28 family pseudogene 2; SCYGR10 KRTAP28p2

UniProt

A0A286YEX9

Expression Region

1-105

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGRCSGGCGGGCGGGCGGGCGGGCGGCGGGCGSYTTCRYYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCGCGKSCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDND2 (NM_152353) Human Recombinant Protein
TP306308L 1 mg

CLDND2 (NM_152353) Human Recombinant Protein

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF568 conjugate, 0.1mg/mL
BNC681925-500 1x 500 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Fluoropropan-1-ol
TRC-F598605-1G 1 g

3-Fluoropropan-1-ol

Sign In for Pricing
View Details
CCDC85B Human Gene Knockout Kit (CRISPR)
KN401086 1 Kit

CCDC85B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITGA11 Human Gene Knockout Kit (CRISPR)
KN416722 1 Kit

ITGA11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Ethylpyrimidine-5-carboxylic Acid
TRC-B436693-10MG 10 mg

4-Ethylpyrimidine-5-carboxylic Acid

Sign In for Pricing
View Details