Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B), Biotinylated

This Recombinant Human Oocyte-secreted protein 4B (OSP4B), Biotinylated spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (2-Bromophenyl) -4-[3- (trifluoromethyl) phenyl]-4H-1,2,4-triazole-3-thiol
CDB64609-01 0.5 g

5- (2-Bromophenyl) -4-[3- (trifluoromethyl) phenyl]-4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
5- (2-Bromophenyl) -4-[3- (trifluoromethyl) phenyl]-4H-1,2,4-triazole-3-thiol
CDB64609-02 5 g

5- (2-Bromophenyl) -4-[3- (trifluoromethyl) phenyl]-4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
Phospho-AMOT (Y599) Antibody
E45R05288G-4 50 µL

Phospho-AMOT (Y599) Antibody

Sign In for Pricing
View Details
Lenti-ORF, MSRB1 (mGFP-tagged) - Human selenoprotein X, 1 (SEPX1), (Note: selenocystein protein, Internal stop codon present. See Summary below)
RC201020L4 10 µg

Lenti-ORF, MSRB1 (mGFP-tagged) - Human selenoprotein X, 1 (SEPX1), (Note: selenocystein protein, Internal stop codon present. See Summary below)

Sign In for Pricing
View Details
SMURF 2 Rabbit mAb
MBS9470568-01 0.05 mL

SMURF 2 Rabbit mAb

Sign In for Pricing
View Details
SMURF 2 Rabbit mAb
MBS9470568-02 0.1 mL

SMURF 2 Rabbit mAb

Sign In for Pricing
View Details