Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH), Biotinylated

This Recombinant Human CUB domain-containing protein (SPADH), Biotinylated spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr734 (NM_146664) Mouse Tagged Lenti ORF Clone
MR214390L4 10 µg

Olfr734 (NM_146664) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Nkx2.5  (S1)
YF-MA12595 100 ug

Anti-Nkx2.5 (S1)

Sign In for Pricing
View Details
Anti-CD166/ALCAM Antibody, Rabbit Polyclonal
MBS8113268-01 0.1 mL

Anti-CD166/ALCAM Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CD166/ALCAM Antibody, Rabbit Polyclonal
MBS8113268-02 5x 0.1 mL

Anti-CD166/ALCAM Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Porcine cluster Of differentiation, CD44 ELISA Kit
GA-E0049PC-01 48 Tests

Porcine cluster Of differentiation, CD44 ELISA Kit

Sign In for Pricing
View Details
Porcine cluster Of differentiation, CD44 ELISA Kit
GA-E0049PC-02 96 Tests

Porcine cluster Of differentiation, CD44 ELISA Kit

Sign In for Pricing
View Details