Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4), Biotinylated

This Recombinant Human G antigen 4 (GAGE4), Biotinylated spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mono(4-carboxybutyl) Phthalate-d4
TRC-M525322-1MG 1 mg

Mono(4-carboxybutyl) Phthalate-d4

Sign In for Pricing
View Details
Brilliant Cresyl blue (Technical Grade)
TRC-B677413-25G 25 g

Brilliant Cresyl blue (Technical Grade)

Sign In for Pricing
View Details
FKLF / KLF11 (KLF11) Rabbit Polyclonal Antibody
TA364506 100 µL

FKLF / KLF11 (KLF11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIRT5 Human Gene Knockout Kit (CRISPR)
KN400189 1 Kit

SIRT5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C9orf96 (STKLD1) activation kit by CRISPRa
GA116187 1 Kit

Human C9orf96 (STKLD1) activation kit by CRISPRa

Sign In for Pricing
View Details
MNAT1 (NM_001177963) Human Over-expression Lysate
LC432796 20 µg

MNAT1 (NM_001177963) Human Over-expression Lysate

Sign In for Pricing
View Details