Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4), Biotinylated

This Recombinant Human G antigen 4 (GAGE4), Biotinylated spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant mouse ASC protein, His
orb1516751-01 20 µg

Recombinant mouse ASC protein, His

Sign In for Pricing
View Details
Recombinant mouse ASC protein, His
orb1516751-02 100 µg

Recombinant mouse ASC protein, His

Sign In for Pricing
View Details
Recombinant mouse ASC protein, His
orb1516751-03 500 µg

Recombinant mouse ASC protein, His

Sign In for Pricing
View Details
Recombinant Salmonella agona UPF0266 membrane protein yobD (yobD)
MBS1215441 Inquire

Recombinant Salmonella agona UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Lentiviral mouse Tcerg1l shRNA (UAS) - Lentiviral mouse Tcerg1l shRNA (UAS, iRFP) plasmid
GTR15263632 1 Vial

Lentiviral mouse Tcerg1l shRNA (UAS) - Lentiviral mouse Tcerg1l shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SOX10 Rabbit mAb
MBS9469981-01 0.05 mL

SOX10 Rabbit mAb

Sign In for Pricing
View Details