Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4), Biotinylated

This Recombinant Human G antigen 4 (GAGE4), Biotinylated spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EBP2 Antibody
CSB-PA007563DA01HU-01 50 µg

EIF4EBP2 Antibody

Sign In for Pricing
View Details
EIF4EBP2 Antibody
CSB-PA007563DA01HU-02 100 µg

EIF4EBP2 Antibody

Sign In for Pricing
View Details
Rabbit Anti-CD11B/ITGAM Polyclonal Antibody
PAV5625 100 μL

Rabbit Anti-CD11B/ITGAM Polyclonal Antibody

Sign In for Pricing
View Details
Olfr74 3'UTR GFP Stable Cell Line
TU165473 1.0 mL

Olfr74 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LOC681989 (Spermatogenesis-Defective Protein 39 Homolog, VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator, spe-39 Homolog)
484948 100 µL

LOC681989 (Spermatogenesis-Defective Protein 39 Homolog, VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator, spe-39 Homolog)

Sign In for Pricing
View Details
Raf1 Rabbit mAb
E45R12749N-100 100 µL

Raf1 Rabbit mAb

Sign In for Pricing
View Details