Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial, Biotinylated

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial, Biotinylated spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Antibody FITC Conjugated
C00238F 100 µL

Protein A Antibody FITC Conjugated

Sign In for Pricing
View Details
Mouse Polyclonal LYAG/GAA Antibody
H00002548-B01P 0.05 mg

Mouse Polyclonal LYAG/GAA Antibody

Sign In for Pricing
View Details
Anti-Msx-2 Antibody
A01783 100 µL

Anti-Msx-2 Antibody

Sign In for Pricing
View Details
Gly-Gly-Arg
HY-P4249 1 Each

Gly-Gly-Arg

Sign In for Pricing
View Details
Monkey Elastase ELISA Kit
EMKE0147 96 Tests

Monkey Elastase ELISA Kit

Sign In for Pricing
View Details
LINC00281 ORF Vector (Human) (pORF)
ORF022814 1.0 µg DNA

LINC00281 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details