Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial, Biotinylated

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial, Biotinylated spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit
MBS9358147-01 48 Well

Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit

Sign In for Pricing
View Details
Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit
MBS9358147-02 96 Well

Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit

Sign In for Pricing
View Details
Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit
MBS9358147-03 5x 96 Well

Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit

Sign In for Pricing
View Details
Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit
MBS9358147-04 10x 96 Well

Hamster Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit

Sign In for Pricing
View Details
SUR1 Antibody, Clone N289/16
SMC-409D 100 µg

SUR1 Antibody, Clone N289/16

Sign In for Pricing
View Details
Impdh2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4492507 1.0 µg DNA

Impdh2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details