Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial, Biotinylated

This Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial, Biotinylated spans the amino acid sequence from region 27-74. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein GAFA-1; Gene associated with FGF-2 activity protein 1; GAFA1

UniProt

Q96PS6

Expression Region

27-74

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORLA/SORL1 Rabbit Polyclonal Antibody (Fluoro488)
orb3112337 100 µg

SORLA/SORL1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (AP)
MBS6329724-01 0.2 mL

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (AP)

Sign In for Pricing
View Details
OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (AP)
MBS6329724-02 5x 0.2 mL

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (AP)

Sign In for Pricing
View Details
Duck Ephrin B2 ELISA Kit
MBS068060 Inquire

Duck Ephrin B2 ELISA Kit

Sign In for Pricing
View Details
CLEC18A Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV708781 1.0 µg DNA

CLEC18A Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Cytokeratin 18 Mouse Monoclonal Antibody (2F7)
MBS8504745-01 0.1 mg

Cytokeratin 18 Mouse Monoclonal Antibody (2F7)

Sign In for Pricing
View Details