Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial

This Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial spans the amino acid sequence from region 431-539. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLCO1B3-SLCO1B7 readthrough transcript protein; Liver specific transporter-3 transmembrane 12; LST-3TM12; Organic anion transporting polypeptide 1B3-1B7; OATP1B3-1B7; Solute carrier organic anion transporter family member 1B3-1B7; SLCO1B3-SLCO1B7; SLCO1B3-SLCO1B7

UniProt

F5H094

Expression Region

431-539

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVYFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Binding Protein 1 Antibody / FABP1
V4875SAF-100UG 100 µg

Fatty Acid Binding Protein 1 Antibody / FABP1

Sign In for Pricing
View Details
USP28 Rabbit Polyclonal Antibody (APC)
orb993736 100 µL

USP28 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Akt1 Polyclonal Antibody
MBS9242664-01 0.1 mL

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Akt1 Polyclonal Antibody
MBS9242664-02 5x 0.1 mL

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit GDP Dissociation Inhibitor 1 ELISA Kit
MBS732357-01 48 Well

Rabbit GDP Dissociation Inhibitor 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit GDP Dissociation Inhibitor 1 ELISA Kit
MBS732357-02 96 Well

Rabbit GDP Dissociation Inhibitor 1 ELISA Kit

Sign In for Pricing
View Details