Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chorionic somatomammotropin hormone 1 (CSH1)

This Recombinant Human Chorionic somatomammotropin hormone 1 (CSH1) spans the amino acid sequence from region 27-217. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorionic somatomammotropin hormone 1; Choriomammotropin; Lactogen; Placental lactogen; PL; CSH1

UniProt

P0DML2

Expression Region

27-217

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lead (II) chloride
LB0560 250g

Lead (II) chloride

Sign In for Pricing
View Details
Rev1 ORF Vector (Mouse) (pORF)
ORF055895 1.0 µg DNA

Rev1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
B.C.G. - Dextrose Agar (Snyder Test Agar)
DM 1106 500 g

B.C.G. - Dextrose Agar (Snyder Test Agar)

Sign In for Pricing
View Details
LRRC62 shRNA (m) Lentiviral Particles
sc-149100-V 200 µL

LRRC62 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
MKRN2 Antibody
orb734430-01 50 μL

MKRN2 Antibody

Sign In for Pricing
View Details
MKRN2 Antibody
orb734430-02 100 µL

MKRN2 Antibody

Sign In for Pricing
View Details