Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chorionic somatomammotropin hormone 1 (CSH1)

This Recombinant Human Chorionic somatomammotropin hormone 1 (CSH1) spans the amino acid sequence from region 27-217. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorionic somatomammotropin hormone 1; Choriomammotropin; Lactogen; Placental lactogen; PL; CSH1

UniProt

P0DML2

Expression Region

27-217

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smim13 Mouse Gene Knockout Kit (CRISPR)
KN516320 1 Kit

Smim13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RBM3 Recombinant Protein (Mouse)
RP167165 100 µg

RBM3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Cad-set siRNA/shRNA/RNAi Lentivector (Mouse)
14908094 4x 500 ng

Cad-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
DUX5 Polyclonal Antibody
E44H09289 100 µL

DUX5 Polyclonal Antibody

Sign In for Pricing
View Details
Human FRS2 (NM_001278353) AAV Particle
RC238620A1V 250 µL

Human FRS2 (NM_001278353) AAV Particle

Sign In for Pricing
View Details
1-Deoxy-1-nitro-L-galactitol
sc-282074A 50 mg

1-Deoxy-1-nitro-L-galactitol

Sign In for Pricing
View Details