Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uridine 5'-monophosphate synthase (UMPS)

This Recombinant Human Uridine 5'-monophosphate synthase (UMPS) spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uridine 5'-monophosphate synthase; UMP synthase; [Includes: Orotate phosphoribosyltransferase; OPRT; OPRTase; EC 2.4.2.10; Orotidine 5'-phosphate decarboxylase; ODC; OMPD; EC 4.1.1.23; OMPdecase] UMPS OK/SW-cl.21

UniProt

P11172

Expression Region

2-480

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Fatty Acid Binding Protein 4, Adipocyte ELISA kit
GTR10450427 96 Well

Monkey Fatty Acid Binding Protein 4, Adipocyte ELISA kit

Sign In for Pricing
View Details
DYNC1I2 (NM_001378) Human Tagged ORF Clone Lentiviral Particle
RC221434L3V 200 µL

DYNC1I2 (NM_001378) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phospho-Histone H2A.X (S139)
E8ET1602-2 100 µL

Phospho-Histone H2A.X (S139)

Sign In for Pricing
View Details
EIF3J Antibody
45974-01 50 µL

EIF3J Antibody

Sign In for Pricing
View Details
EIF3J Antibody
45974-02 100 µL

EIF3J Antibody

Sign In for Pricing
View Details
HAUS5 Protein Lysate (Human) with C-Ha Tag
23026031 100 µg

HAUS5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details