Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Azurocidin (CAP7)

This Recombinant Human Azurocidin (CAP7) spans the amino acid sequence from region 27-248. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Azurocidin; Cationic antimicrobial protein CAP37; Heparin-binding protein; HBP; hHBP; AZU1

UniProt

P20160

Expression Region

27-248

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKAG01078-96W - TIE2 Colorimetric Cell-Based ELISA Kit
OKAG01078-96W 96 Well

OKAG01078-96W - TIE2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
blaNDM-1 Antibody
MBS7002961-01 0.05 mg

blaNDM-1 Antibody

Sign In for Pricing
View Details
blaNDM-1 Antibody
MBS7002961-02 0.1 mg

blaNDM-1 Antibody

Sign In for Pricing
View Details
blaNDM-1 Antibody
MBS7002961-03 5x 0.1 mg

blaNDM-1 Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 90 (CD90)
TRV-0035967-01 20 µL

Monoclonal Antibody to Cluster of Differentiation 90 (CD90)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 90 (CD90)
TRV-0035967-02 100 µL

Monoclonal Antibody to Cluster of Differentiation 90 (CD90)

Sign In for Pricing
View Details