Recombinant Human Calmodulin-regulated spectrin-associated protein 2 (CAMP2), partial
This Recombinant Human Calmodulin-regulated spectrin-associated protein 2 (CAMP2), partial spans the amino acid sequence from region 1349-1483. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Calmodulin-regulated spectrin-associated protein 2; Calmodulin-regulated spectrin-associated protein 1-like protein 1; CAMSAP2 CAMSAP1L1 KIAA1078
UniProt
Q08AD1
Expression Region
1349-1483
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2400566-01 0.05 mg
Anti-CD144/CDH5/VE Cadherin Antibody (clone 16B1)
Sign In for Pricing
View Details MBS2400566-02 5x 0.05 mg
Anti-CD144/CDH5/VE Cadherin Antibody (clone 16B1)
Sign In for Pricing
View Details GTR10471122 96 Well
Goat 10 kDa heat shock protein, mitochondrial (HSPE1) ELISA kit
Sign In for Pricing
View Details