Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial

This Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial spans the amino acid sequence from region 895-1007. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fanconi-associated nuclease 1; EC 3.1.21.-; EC 3.1.4.1; FANCD2/FANCI-associated nuclease 1; hFAN1; Myotubularin-related protein 15; FAN1 KIAA1018 MTMR15

UniProt

Q9Y2M0

Expression Region

895-1007

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EESLRAWVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forceps Artery Bulldog 38mm Straight
INS4200 1 Each

Forceps Artery Bulldog 38mm Straight

Sign In for Pricing
View Details
Mouse CDHR3 siRNA
abx911238-01 15 nmol

Mouse CDHR3 siRNA

Sign In for Pricing
View Details
Mouse CDHR3 siRNA
abx911238-02 30 nmol

Mouse CDHR3 siRNA

Sign In for Pricing
View Details
ALMT1 Antibody
PHY3955S 150 μg

ALMT1 Antibody

Sign In for Pricing
View Details
MAN1A2 Rabbit Polyclonal Antibody
orb514642 100 µg

MAN1A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MARCKS
525188-01 100 µL

MARCKS

Sign In for Pricing
View Details