Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial fission 1 protein (FIS1), partial

This Recombinant Human Mitochondrial fission 1 protein (FIS1), partial spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial fission 1 protein; FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; FIS1 TTC11 CGI-135

UniProt

Q9Y3D6

Expression Region

1-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRLH Rabbit Polyclonal Antibody
orb1880552-01 30 µL

PRLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRLH Rabbit Polyclonal Antibody
orb1880552-02 50 µL

PRLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRLH Rabbit Polyclonal Antibody
orb1880552-03 100 µL

PRLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRLH Rabbit Polyclonal Antibody
orb1880552-04 200 µL

PRLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nectin3 (NM_001105883) Rat Tagged Lenti ORF Clone
RR203401L3 10 µg

Nectin3 (NM_001105883) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human TBL1Y Protein
E30P69631A 50 µg

Recombinant Human TBL1Y Protein

Sign In for Pricing
View Details