Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial

This Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial spans the amino acid sequence from region 270-308. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proton-coupled zinc antiporter SLC30A1; Solute carrier family 30 member 1; Zinc transporter 1; SLC30A1 ZNT1

UniProt

Q9Y6M5

Expression Region

270-308

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTHASVYEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RDH14 (NM_020905) Human Over-expression Lysate
LC412210 20 µg

RDH14 (NM_020905) Human Over-expression Lysate

Sign In for Pricing
View Details
AdmiRa-hsa-miR-520h-Off Virus
mh5949 1.0 mL

AdmiRa-hsa-miR-520h-Off Virus

Sign In for Pricing
View Details
VWA5B2 (NM_138345) Human Over-expression Lysate
LS090113 100 µg

VWA5B2 (NM_138345) Human Over-expression Lysate

Sign In for Pricing
View Details
Syntaxin 1A, Brain Phospho-Ser14 (STX1A pS14) Antibody
abx329213-01 50 µg

Syntaxin 1A, Brain Phospho-Ser14 (STX1A pS14) Antibody

Sign In for Pricing
View Details
Syntaxin 1A, Brain Phospho-Ser14 (STX1A pS14) Antibody
abx329213-02 100 µg

Syntaxin 1A, Brain Phospho-Ser14 (STX1A pS14) Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Neprilysin/CD10 Antibody (MME/8376R) [DyLight 488]
NBP3-20771G 0.1 mL

Rabbit Monoclonal Neprilysin/CD10 Antibody (MME/8376R) [DyLight 488]

Sign In for Pricing
View Details