Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein myomixer (MYMX), partial

This Recombinant Human Protein myomixer (MYMX), partial spans the amino acid sequence from region 26-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein myomixer; Microprotein inducer of fusion; Protein minion; hMINION; MYMX

UniProt

A0A1B0GTQ4

Expression Region

26-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18A (C-term) Rabbit Polyclonal Antibody
AP53710PU-N 400 µL

RPL18A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lumazine
TRC-L473800-1G 1 g

Lumazine

Sign In for Pricing
View Details
Plant Growth Chamber BCPG-103
BCPG-103 1 Unit

Plant Growth Chamber BCPG-103

Sign In for Pricing
View Details
BAI3 (ADGRB3) (NM_001704) Human Recombinant Protein
TP720363XL 1 mg

BAI3 (ADGRB3) (NM_001704) Human Recombinant Protein

Sign In for Pricing
View Details
Human SYT11 activation kit by CRISPRa
GA108125 1 Kit

Human SYT11 activation kit by CRISPRa

Sign In for Pricing
View Details
Connexin 43 Recombinant Rabbit monoclonal Antibody
HA750606 100 µL

Connexin 43 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details