Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 20-1 (TVBT1)

This Recombinant Human T cell receptor beta variable 20-1 (TVBT1) spans the amino acid sequence from region 16-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 20-1 TRBV20-1

UniProt

A0A075B6N2

Expression Region

16-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipeptidyl Peptidase 4 (CD26) Antibody
abx412941 0.2 mg

Dipeptidyl Peptidase 4 (CD26) Antibody

Sign In for Pricing
View Details
pBluescriptR-PPFIA1 Plasmid
PVT14729 2 µg

pBluescriptR-PPFIA1 Plasmid

Sign In for Pricing
View Details
Human Keratin, type I cytoskeletal 18 ELISA Kit
EK3022 Inquire

Human Keratin, type I cytoskeletal 18 ELISA Kit

Sign In for Pricing
View Details
Human Soluble Receptor Activator Of Nuclear Factor-kB Ligand (sRANKL) ELISA Kit
MBS9713875-01 48 Tests

Human Soluble Receptor Activator Of Nuclear Factor-kB Ligand (sRANKL) ELISA Kit

Sign In for Pricing
View Details
Human Soluble Receptor Activator Of Nuclear Factor-kB Ligand (sRANKL) ELISA Kit
MBS9713875-02 96 Tests

Human Soluble Receptor Activator Of Nuclear Factor-kB Ligand (sRANKL) ELISA Kit

Sign In for Pricing
View Details
Human Soluble Receptor Activator Of Nuclear Factor-kB Ligand (sRANKL) ELISA Kit
MBS9713875-03 5x 96 Tests

Human Soluble Receptor Activator Of Nuclear Factor-kB Ligand (sRANKL) ELISA Kit

Sign In for Pricing
View Details