Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30)

This Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-30 IGKV2D-30

UniProt

A0A075B6S6

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3AP1 (C-term) Rabbit Polyclonal Antibody
AP53304PU-N 400 µL

PIK3AP1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Behenic Acid-d43
TRC-B119582-5MG 5 mg

Behenic Acid-d43

Sign In for Pricing
View Details
Monocrotaline
TRC-M526000-50MG 50 mg

Monocrotaline

Sign In for Pricing
View Details
MOK protein kinase (MOK) Mouse Monoclonal Antibody [Clone ID: OTI6C12]
CF810865 100 µg

MOK protein kinase (MOK) Mouse Monoclonal Antibody [Clone ID: OTI6C12]

Sign In for Pricing
View Details
PE Anti-Mouse CD41 Antibody[MWReg30]
E-AB-F1183UD-01 25 µg

PE Anti-Mouse CD41 Antibody[MWReg30]

Sign In for Pricing
View Details
PE Anti-Mouse CD41 Antibody[MWReg30]
E-AB-F1183UD-02 100 µg

PE Anti-Mouse CD41 Antibody[MWReg30]

Sign In for Pricing
View Details