Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30)

This Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-30 IGKV2D-30

UniProt

A0A075B6S6

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ataxin 3 (ATXN3) (NM_001127696) Human Over-expression Lysate
LC426854 20 µg

Ataxin 3 (ATXN3) (NM_001127696) Human Over-expression Lysate

Sign In for Pricing
View Details
Aaas Mouse Gene Knockout Kit (CRISPR)
KN500574 1 Kit

Aaas Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (rLAMP4/824), Biotin conjugate, 0.1mg/mL
BNCB3434-100 1x 100 µL

CD68 (Macrophage Marker) (rLAMP4/824), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565672 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
PLXNB3 (NM_001163257) Human Over-expression Lysate
LY431728 100 µg

PLXNB3 (NM_001163257) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat LH (Luteinizing Hormone) ELISA Kit
E-EL-R0026-01 24 Tests

Rat LH (Luteinizing Hormone) ELISA Kit

Sign In for Pricing
View Details