Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30)

This Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-30 IGKV2D-30

UniProt

A0A075B6S6

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetylcholinesterase Blocking Peptide
abx062201-01 1 mg

Acetylcholinesterase Blocking Peptide

Sign In for Pricing
View Details
Acetylcholinesterase Blocking Peptide
abx062201-02 5 mg

Acetylcholinesterase Blocking Peptide

Sign In for Pricing
View Details
Pate10 Mouse siRNA Oligo Duplex (Locus ID 100312949)
SR401680 1 Kit

Pate10 Mouse siRNA Oligo Duplex (Locus ID 100312949)

Sign In for Pricing
View Details
REEP5 Rabbit pAb, IRDye 800CW conjugated
orb2866567 100 µL

REEP5 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
AGN 193109 Ethyl Ester
TRC-A427010-1MG 1 mg

AGN 193109 Ethyl Ester

Sign In for Pricing
View Details
Propargite
M28239-01 1 g

Propargite

Sign In for Pricing
View Details