Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83)

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CCL4 Antibody
RC-16129-01 50 μL

Recombinant CCL4 Antibody

Sign In for Pricing
View Details
Recombinant CCL4 Antibody
RC-16129-02 100 µL

Recombinant CCL4 Antibody

Sign In for Pricing
View Details
Recombinant CCL4 Antibody
RC-16129-03 1 mL

Recombinant CCL4 Antibody

Sign In for Pricing
View Details
p16INK4a Recombinant Rabbit Monoclonal Antibody [SU0702]
ET1608-62 100 µL

p16INK4a Recombinant Rabbit Monoclonal Antibody [SU0702]

Sign In for Pricing
View Details
LGALS3 Polyclonal Antibody
E-AB-60313-01 60 µL

LGALS3 Polyclonal Antibody

Sign In for Pricing
View Details
LGALS3 Polyclonal Antibody
E-AB-60313-02 120 µL

LGALS3 Polyclonal Antibody

Sign In for Pricing
View Details