Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83)

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTNAP3B Human Gene Knockout Kit (CRISPR)
KN435254 1 Kit

CNTNAP3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ProSeries™ Performance Centrifuge Tubes
C2802 500 Units/Case

ProSeries™ Performance Centrifuge Tubes

Sign In for Pricing
View Details
Dersimelagon Dihydrochloride
TRC-D854260-25MG 25 mg

Dersimelagon Dihydrochloride

Sign In for Pricing
View Details
1-Cyclohexyl-3-(p-sulfamoylphenethyl)urea
TRC-C988210-2.5G 2.5 g

1-Cyclohexyl-3-(p-sulfamoylphenethyl)urea

Sign In for Pricing
View Details
EMPA
TRC-E521550-50MG 50 mg

EMPA

Sign In for Pricing
View Details
(S)-Anabasine, > 98% ee
TRC-A637170-50MG 50 mg

(S)-Anabasine, > 98% ee

Sign In for Pricing
View Details