Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arg-Trp
orb1980867-01 5 mg

Arg-Trp

Sign In for Pricing
View Details
Arg-Trp
orb1980867-02 50 mg

Arg-Trp

Sign In for Pricing
View Details
Carboxypeptidase A1/CPA1 Protein (C-His, Human)
P513683 100 µg

Carboxypeptidase A1/CPA1 Protein (C-His, Human)

Sign In for Pricing
View Details
Anti-CD39/ENTPD1 Antibody Picoband®, Dylight550 Conjugate
A03196-3-Dylight550 100 µg

Anti-CD39/ENTPD1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
BT3A3 rabbit pAb
MBS8600683-01 0.1 mL

BT3A3 rabbit pAb

Sign In for Pricing
View Details
BT3A3 rabbit pAb
MBS8600683-02 0.1 mL (AF405L)

BT3A3 rabbit pAb

Sign In for Pricing
View Details