Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIAH1 (NM_001006610) Human Tagged Lenti ORF Clone
RC211475L1 10 µg

SIAH1 (NM_001006610) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
EIF4H Polyclonal Antibody, HRP Conjugated
bs-14553R-HRP 100 µL

EIF4H Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
5-[4- (Isobutyrylamino) anilino]-5-oxopentanoic acid
sc-317985 500 mg

5-[4- (Isobutyrylamino) anilino]-5-oxopentanoic acid

Sign In for Pricing
View Details
Human Homeobox protein HMX2 (HMX2) ELISA Kit
abx527254 96 Tests

Human Homeobox protein HMX2 (HMX2) ELISA Kit

Sign In for Pricing
View Details
CCDC89 Antibody, Biotin conjugated
A61455-100UG 100 µg

CCDC89 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-TSH Receptor/TSHR Antibody Picoband® (iFluor647 Conjugate)
A00576-1-iFluor647 100 µg

Anti-TSH Receptor/TSHR Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details