Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Claudin 2/CLDN2 Antibody Picoband® (Biotine Conjugate)
A03033-1-Biotin 100 µg/Vial

Anti-Claudin 2/CLDN2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
RASEF 3'UTR Luciferase Stable Cell Line
TU019536 1.0 mL

RASEF 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Signal transducer and activator of transcription 3 ELISA Kit
MBS2885416-01 48 Well

Mouse Signal transducer and activator of transcription 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Signal transducer and activator of transcription 3 ELISA Kit
MBS2885416-02 96 Well

Mouse Signal transducer and activator of transcription 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Signal transducer and activator of transcription 3 ELISA Kit
MBS2885416-03 5x 96 Well

Mouse Signal transducer and activator of transcription 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Signal transducer and activator of transcription 3 ELISA Kit
MBS2885416-04 10x 96 Well

Mouse Signal transducer and activator of transcription 3 ELISA Kit

Sign In for Pricing
View Details