Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-2 (TVA12)

This Recombinant Human T cell receptor alpha variable 1-2 (TVA12) spans the amino acid sequence from region 19-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-2 TRAV1-2

UniProt

A0A0B4J238

Expression Region

19-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit
MBS2803927-01 48 Tests

Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit

Sign In for Pricing
View Details
Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit
MBS2803927-02 96 Tests

Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit

Sign In for Pricing
View Details
Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit
MBS2803927-03 5x 96 Tests

Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit

Sign In for Pricing
View Details
Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit
MBS2803927-04 10x 96 Tests

Mouse UDP-glucuronosyltransferase 1-6 (UGT1A6) ELISA Kit

Sign In for Pricing
View Details
Phospho-CDK2 (Thr14) Rabbit Polyclonal Antibody (RBITC)
orb1045161 100 µL

Phospho-CDK2 (Thr14) Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
6- (Methylamino) -2,3,4,5-tetrahydro-1,2,4-triazine-3,5-dione
PCA84242-01 50 mg

6- (Methylamino) -2,3,4,5-tetrahydro-1,2,4-triazine-3,5-dione

Sign In for Pricing
View Details