Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)
MBS1240800-01 0.02 mg (E-Coli)

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)
MBS1240800-02 0.1 mg (E-Coli)

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)
MBS1240800-03 0.02 mg (Yeast)

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)
MBS1240800-04 0.1 mg (Yeast)

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)
MBS1240800-05 0.02 mg (Baculovirus)

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)
MBS1240800-06 0.02 mg (Mammalian-Cell)

Recombinant Streptococcus suis Probable DNA-directed RNA polymerase subunit delta (rpoE)

Sign In for Pricing
View Details