Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEK293-KCNN4 cell line with RFP and Puromycin dual marker
SC025-RB 2x 10^6 Cell/mL - 1 mL

HEK293-KCNN4 cell line with RFP and Puromycin dual marker

Sign In for Pricing
View Details
DDX56 shRNA (m) Lentiviral Particles
sc-105281-V 200 µL

DDX56 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
GTF2IRD1 Rabbit pAb, AE conjugated
orb2864207 100 µL

GTF2IRD1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
GENLISA Human Nucleoporin 85kDa (NUP-85 / NUP85) ELISA
KBH14075 1x 96 Well

GENLISA Human Nucleoporin 85kDa (NUP-85 / NUP85) ELISA

Sign In for Pricing
View Details
Monkey Dipeptidyl Peptidase IV ELISA kit
GTR10467531 96 Well

Monkey Dipeptidyl Peptidase IV ELISA kit

Sign In for Pricing
View Details
MAGED2 (NM_014599) Human Tagged Lenti ORF Clone
RC201748L2 10 µg

MAGED2 (NM_014599) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details