Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit polyclonal eIF4G antibody
MBS5304831-01 0.05 mg

Rabbit polyclonal eIF4G antibody

Sign In for Pricing
View Details
Rabbit polyclonal eIF4G antibody
MBS5304831-02 5x 0.05 mg

Rabbit polyclonal eIF4G antibody

Sign In for Pricing
View Details
Human ROR alpha/NR1F1 Alexa Fluor 700 Antibody
IC8924N-100UG 100 µg

Human ROR alpha/NR1F1 Alexa Fluor 700 Antibody

Sign In for Pricing
View Details
A77 1726
1973-5 5 mg

A77 1726

Sign In for Pricing
View Details
Lentiviral mouse Muc5b shRNA (UAS) - Lentiviral mouseMuc5b shRNA (UAS, GFP) (25)
GTR15205760 1 Vial

Lentiviral mouse Muc5b shRNA (UAS) - Lentiviral mouseMuc5b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Mitofusin 1 (MFN1)
MBS2067179-01 0.1 mL

FITC-Linked Polyclonal Antibody to Mitofusin 1 (MFN1)

Sign In for Pricing
View Details