Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
EK243123 96 Well

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human Monoclonal CD20 Antibody (Hu2) [DyLight 405]
FAB9575E 0.1 mL

Human Monoclonal CD20 Antibody (Hu2) [DyLight 405]

Sign In for Pricing
View Details
MT-ND5/MT Rabbit Polyclonal Antibody (Fluoro550)
orb3107802 100 µg

MT-ND5/MT Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Mouse Lymphotoxin beta R Recombinant Protein C-Fc Tag Lyophilized 50UG
IMSLTBRRCFCLY50UG 50 µg

Mouse Lymphotoxin beta R Recombinant Protein C-Fc Tag Lyophilized 50UG

Sign In for Pricing
View Details
Purified Anti-Mouse CD8a Antibody[53-6.7]
FCE2409-01 25 µg

Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
Purified Anti-Mouse CD8a Antibody[53-6.7]
FCE2409-02 100 µg

Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details