Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD2 Mouse Monoclonal Antibody [Clone 1G6]
E45M11526V-2 50 µL

PSMD2 Mouse Monoclonal Antibody [Clone 1G6]

Sign In for Pricing
View Details
[1- (Oxan-4-yl) azetidin-2-yl]methanamine
CFD80191-01 50 mg

[1- (Oxan-4-yl) azetidin-2-yl]methanamine

Sign In for Pricing
View Details
[1- (Oxan-4-yl) azetidin-2-yl]methanamine
CFD80191-02 0.5 g

[1- (Oxan-4-yl) azetidin-2-yl]methanamine

Sign In for Pricing
View Details
N- (3- (tert-butyl) -2-methyl-4-oxoindeno[3,2-c]pyrazol-6-yl) -2-methylpropanamide
JAB15497 250 mg

N- (3- (tert-butyl) -2-methyl-4-oxoindeno[3,2-c]pyrazol-6-yl) -2-methylpropanamide

Sign In for Pricing
View Details
AW551984 shRNA (m) Lentiviral Particles
sc-141410-V 200 µL

AW551984 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Phospho-NLK (Thr298) Polyclonal Antibody, PE-Cy7 Conjugated
bs-10421R-PE-Cy7 100 µL

Phospho-NLK (Thr298) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details