Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-4 (TVB54)

This Recombinant Human T cell receptor beta variable 5-4 (TVB54) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-4 TRBV5-4

UniProt

A0A0C4DH59

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSSQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFPPRFSGLQFPNYSSELNVNALELDDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nonadecane (Standard)
HY-N7928R-01 10 mg

Nonadecane (Standard)

Sign In for Pricing
View Details
Nonadecane (Standard)
HY-N7928R-02 25 mg

Nonadecane (Standard)

Sign In for Pricing
View Details
Nonadecane (Standard)
HY-N7928R-03 50 mg

Nonadecane (Standard)

Sign In for Pricing
View Details
Nonadecane (Standard)
HY-N7928R-04 100 mg

Nonadecane (Standard)

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H1.4 [p Thr17] Antibody (3E1)
NBP3-26420-50ul 50 µL

Rabbit Monoclonal Histone H1.4 [p Thr17] Antibody (3E1)

Sign In for Pricing
View Details
Alexa Fluor 647 anti-human CD14
FC0374 100 Tests

Alexa Fluor 647 anti-human CD14

Sign In for Pricing
View Details