Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1)

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TAS2R60 sgRNA gene knockout kit - Lentiviral human TAS2R60 sgRNA gene knockout kit (100)
GTR15390889 1 Vial

Lentiviral human TAS2R60 sgRNA gene knockout kit - Lentiviral human TAS2R60 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Anti-THOC6 antibody
PAab08669 100 µg

Anti-THOC6 antibody

Sign In for Pricing
View Details
CACNA2D1 Human Pre-designed siRNA Set A
HY-RS01801 1 Set

CACNA2D1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
LCE3C sgRNA CRISPR Lentivector (Human) (Target 1)
K1200902 1.0 µg DNA

LCE3C sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
KAZN siRNA (Rat)
MBS8228720-01 15 nmol

KAZN siRNA (Rat)

Sign In for Pricing
View Details
KAZN siRNA (Rat)
MBS8228720-02 30 nmol

KAZN siRNA (Rat)

Sign In for Pricing
View Details