Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial
This Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial spans the amino acid sequence from region 24-59. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mitochondrial sheath formation-associated protein; Putative transmembrane protein SPTY2D1OS; SPTY2D1 antisense RNA 1; SPTY2D1 opposite strand; MISFA SPTY2D1-AS1 SPTY2D1OS
UniProt
A0A0U1RRN3
Expression Region
24-59
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
PPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I41BBRHISLY100UG 100 µg
4-1BB Recombinant Protein His Tag Lyophilized 100UG
Sign In for Pricing
View Details 