Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72)

This Recombinant Human T cell receptor beta variable 7-2 (TVB72) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl5 (NM_001047093) Rat Tagged ORF Clone Lentiviral Particle
RR200988L3V 200 µL

Klhl5 (NM_001047093) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
A-Naphthol Solution
V0192 00125 125 mL

A-Naphthol Solution

Sign In for Pricing
View Details
Rabbit Monoclonal HLA-DR Antibody (HLA-DRA/6840R) - Azide and BSA Free
NBP3-20837 100 µg

Rabbit Monoclonal HLA-DR Antibody (HLA-DRA/6840R) - Azide and BSA Free

Sign In for Pricing
View Details
Recombinant Yersinia pestis ATP synthase subunit c (atpE)
MBS1022762 Inquire

Recombinant Yersinia pestis ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Zfp516 ORF Vector (Mouse) (pORF)
ORF062409 1.0 µg DNA

Zfp516 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
C1orf145 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15023R-BF594 100 µL

C1orf145 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details