Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-8 (TVB58)

This Recombinant Human T cell receptor beta variable 5-8 (TVB58) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-8 TRBV5-8 TCRBV5S4A2T

UniProt

A0A5A2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD21 Antibody (GB25A)
NBP2-60855 0.1 mg

Mouse Monoclonal CD21 Antibody (GB25A)

Sign In for Pricing
View Details
PTPN5 sgRNA CRISPR Lentivector set (Human)
K1755701 3x 1.0 µg

PTPN5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
(Perfluorooctyl)ethyl Acrylate
TRC-P286215-100G 100 g

(Perfluorooctyl)ethyl Acrylate

Sign In for Pricing
View Details
Sgcd (NM_001109029) Rat Tagged ORF Clone Lentiviral Particle
RR200031L4V 200 µL

Sgcd (NM_001109029) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR563011 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: transverse
CD564691 5 µg

Tissue Genomic DNA, Colon: transverse

Sign In for Pricing
View Details