Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial

This Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative dispanin subfamily A member 2d; DSPA2d

UniProt

C9JQL5

Expression Region

1-57

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHD finger protein 6 (PHF6) (NM_032458) AAV Particle
RC223100A1V 250 µL

Human PHD finger protein 6 (PHF6) (NM_032458) AAV Particle

Sign In for Pricing
View Details
LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (APC)
MBS6167039-01 0.1 mL

LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (APC)

Sign In for Pricing
View Details
LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (APC)
MBS6167039-02 5x 0.1 mL

LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (APC)

Sign In for Pricing
View Details
SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE) (MaxLight 550)
MBS6402304-01 0.1 mL

SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE) (MaxLight 550)

Sign In for Pricing
View Details
SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE) (MaxLight 550)
MBS6402304-02 5x 0.1 mL

SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE) (MaxLight 550)

Sign In for Pricing
View Details
Gm15070 Protein Vector (Mouse) (pPM-C-His)
PV183373 500 ng

Gm15070 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details