Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin alpha-2 heavy chain (IGA2)

This Recombinant Human Immunoglobulin alpha-2 heavy chain (IGA2) spans the amino acid sequence from region 1-455. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin alpha-2 heavy chain; Immunoglobulin alpha-2 heavy chain BUT

UniProt

P0DOX2

Expression Region

1-455

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVETGGGLIQPGGSLRLSCAASGFTVSNHSMSWVRQAPGKALEWVSAIYRGGTTYYADSVKGRFTISRDDSRNTVYLQMNSLRAEDTAVYYCARDLAAARLFGKGTTVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNSSQDVTVPCRVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVEGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRVAAEDWKKGETFSCMVGHEALPLAFTQKTIDRLAGKPTHINVSVVMAEADGTCY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdha10 (NM_053939) Rat Tagged ORF Clone
RR210635 10 µg

Pcdha10 (NM_053939) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Nfyc sgRNA CRISPR Lentivector set (Mouse)
K4755501 3x 1.0 µg

Nfyc sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human RAB3A shRNA Plasmid
abx953954-01 150 µg

Human RAB3A shRNA Plasmid

Sign In for Pricing
View Details
Human RAB3A shRNA Plasmid
abx953954-02 300 µg

Human RAB3A shRNA Plasmid

Sign In for Pricing
View Details
Anti-EAAT2 Antibody
MBS8322176-01 0.03 mL

Anti-EAAT2 Antibody

Sign In for Pricing
View Details
Anti-EAAT2 Antibody
MBS8322176-02 0.05 mL

Anti-EAAT2 Antibody

Sign In for Pricing
View Details