Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial

This Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial spans the amino acid sequence from region 29-703. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-set and immunoglobulin domain-containing protein 10-like 2 VSIG10L2

UniProt

P0DP72

Expression Region

29-703

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPHPTPEAPVEEVVSVQGVRGGSVELACGSGPAPLLVLWSFTPLGSLVPRPVAVTDGAMSKVEAIASALGVVSLRNSSLVLGELHEGARGHFLCQVLHVAGGQLHAAYSHLTLAVLVPVSKPQVRLSNPSPVEGASVVATCAVREGTEPVTFAWQHRAPRGLGEALVGVTEPLFQLDPVNRTHLGWYMCSASNSVNRLSSDGAFLDVIYGPDKPVITMEPLGLTEEGFWASEREEVTLSCLAASNPPSHYVWLRDHTQVHTGPTYVIARAGRVHTGLYTCLARNSYLDTRTQTTVQLTIYYPPEGQPSCAVHPSPEAVTLLCAWPGGLPPAQLQWEGPQGPGPTAPSNVTWSHAAAQLPSGSVFTCTGQHPALAPPALCTVMLWEPLGRPTCWSTATMGDQFIMLSCEWPGGEPPATLGWLDEQQQPLGGSSSSMAVHLLQAQEDLAGREFTCRGTHLLRTPDPHCHLQLEAPQLDVAEPRVSVLEGGEAWLECSLRGGTPPAQLLWLGPQQQKVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARNAVGNSSQSVLLEVLRYPAPPNVTISRLTYGRHRREVQLQWAILGPGNLTGFLVQRKASALGPGAGAWETAASDIEPESRGRRLGGLDPGVLYAFRILALNHHTAGHPSEVKIPADPPFSAYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3B Antibody - C-terminal region
ARP86852_P050-25UL 25 µL

EIF3B Antibody - C-terminal region

Sign In for Pricing
View Details
Lentiviral human SLC16A4 sgRNA gene knockout kit - Lentiviral human SLC16A4 sgRNA gene knockout kit (25)
GTR15395757 1 Vial

Lentiviral human SLC16A4 sgRNA gene knockout kit - Lentiviral human SLC16A4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rat Aromatase (ARO) ELISA Kit
DLR-ARO-Ra-48T 48 Tests

Rat Aromatase (ARO) ELISA Kit

Sign In for Pricing
View Details
Human CD38/ADPRC1 Antibody , FITC
E55A07438 50 Tests

Human CD38/ADPRC1 Antibody , FITC

Sign In for Pricing
View Details
NPEPPS Human shRNA Lentiviral Particle (Locus ID 9520)
TL311124V 500 µL Each

NPEPPS Human shRNA Lentiviral Particle (Locus ID 9520)

Sign In for Pricing
View Details
MAb to THC
MBS312452 Inquire

MAb to THC

Sign In for Pricing
View Details